PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A04G1486
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 482aa    MW: 53414.7 Da    PI: 7.7834
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A04G1486genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.19.2e-42188265178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +CqvegC+ dls+a++yhr+hkvCe hsk+p+v+vsgle+rfCqqCsrfh+lsefDe+krsCrrrL++hn+rrrk+q+
  Gh_A04G1486 188 RCQVEGCNLDLSSARDYHRKHKVCENHSKSPKVIVSGLERRFCQQCSRFHALSEFDENKRSCRRRLSDHNARRRKPQT 265
                  6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.6E-33183250IPR004333Transcription factor, SBP-box
PROSITE profilePS5114133.026186263IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.26E-39187268IPR004333Transcription factor, SBP-box
PfamPF031104.8E-32189262IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MSFISLMEWN EQTPLQWDWE NLMLNAKATE IPRRLRPVEW DIDEGEGGLD SVSVNSSSVA  60
GCSGGSGSDL GLVSLSKNLK SASIDSLSMG EAKLTKFTLE ASEAIPDDIS NKKEVSGIET  120
TSTSLTLVAS VGSGEPLLSL KLGKQTYFED VSTGTNATDS SYSATLGTSS PLSAKRSKLN  180
CRSTHAVRCQ VEGCNLDLSS ARDYHRKHKV CENHSKSPKV IVSGLERRFC QQCSRFHALS  240
EFDENKRSCR RRLSDHNARR RKPQTEATHF NAARIPSLSS SSYDGKQRTS FVWNEVPILH  300
NARPNKKFAL EGTFYSKSSQ MTSYTPTKLG NINEQVQLPI NQLSNPITMR CHDFNKFLPS  360
KGKQNTAEVL DGGVEQSMVA SNTGRAQELQ RALSLLSNDS QISSEPKHGS LTYPIMHVNL  420
TSTSQPAMNA IPQGFQHALP ENWQIEQQEE TTTKSRMHTS DVDDRFREFL LLKAPYDVGF  480
YS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-281892621184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.35400.0boll| leaf| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223190.0KJ622319.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL11) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012458624.10.0PREDICTED: squamosa promoter-binding-like protein 2
RefseqXP_012458626.10.0PREDICTED: squamosa promoter-binding-like protein 2
RefseqXP_012458627.10.0PREDICTED: squamosa promoter-binding-like protein 2
RefseqXP_012458628.10.0PREDICTED: squamosa promoter-binding-like protein 2
RefseqXP_012458629.10.0PREDICTED: squamosa promoter-binding-like protein 2
RefseqXP_012458630.10.0PREDICTED: squamosa promoter-binding-like protein 2
RefseqXP_012458631.10.0PREDICTED: squamosa promoter-binding-like protein 2
TrEMBLA0A0B0PMQ30.0A0A0B0PMQ3_G
STRINGVIT_01s0010g03710.t011e-143(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65622644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.33e-73squamosa promoter binding protein-like 2